2.50 Rating by CuteStat

pagii.com is 1 decade 6 years old. It is a domain having com extension. It has a global traffic rank of #92014 in the world. This website is estimated worth of $ 158,400.00 and have a daily income of around $ 220.00. As no active threats were reported recently by users, pagii.com is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 18,295
Daily Pageviews: 109,770

Estimated Valuation

Income Per Day: $ 220.00
Estimated Worth: $ 158,400.00

Search Engine Indexes

Google Indexed Pages: 353
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 118,000,000
Bing Backlinks: 4,940

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 92,014
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

208.91.196.72

Hosted Country:

British Virgin Islands VG

Location Latitude:

18.5

Location Longitude:

-64.5

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: Not Applicable
Google Adsense: Not Applicable Google Analytics: Not Applicable

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Wed, 11 Dec 2019 14:01:44 GMT
Server: Apache
X-Adblock-Key: MFwwDQYJKoZIhvcNAQEBBQADSwAwSAJBAKX74ixpzVyXbJprcLfbH4psP4+L2entqri0lzh6pkAaXLPIcclv6DQBeJJjGFWrBIF6QMyFwXT5CCRyjS2penECAwEAAQ==_oNfNzhx8XQ3k8smadu6AOdxhRdtudwiiXN8aou+NpSRGoL2iCiGXWinRNbmzYynsPLPdDN9+QuBkpTulU3MUoQ==
Content-Type: text/html; charset=UTF-8
Cache-Control: private
Content-Encoding: gzip
Transfer-Encoding: chunked

Domain Information

Domain Registrar: acens Technologies, S.L.U.
Registration Date: May 29, 2007, 11:07 AM 1 decade 6 years 10 months ago
Expiration Date: May 29, 2020, 11:07 AM 3 years 11 months 2 days ago
Domain Status:
clienttransferprohibited
clientupdateprohibited
clientrenewprohibited
clientdeleteprohibited

Domain Nameserver Information

Host IP Address Country
sk.s5.ans1.ns142.ztomy.com 208.91.196.72 British Virgin Islands British Virgin Islands
sk.s5.ans2.ns142.ztomy.com 199.79.60.72 British Virgin Islands British Virgin Islands

DNS Record Analysis

Host Type TTL Extra
pagii.com A 300 IP: 208.91.196.72
pagii.com NS 300 Target: sk.s5.ans1.ns142.ztomy.com
pagii.com NS 300 Target: sk.s5.ans2.ns142.ztomy.com
pagii.com SOA 300 MNAME: sk.s5.ans1.ns142.ztomy.com
RNAME: abuse.opticaljungle.com
Serial: 2011062801
Refresh: 3600
Retry: 900
Expire: 604800
Minimum TTL: 86400
pagii.com PTR 300 Target: sk.s5.ans1.ns142.ztomy.com
pagii.com TXT 300 TXT: ~

Similarly Ranked Websites

Jornal Correio Paulista | A Marca da Comunicação

- correiopaulista.com
92,015 $ 158,400.00

Elite Marketing Pro | Welcome

- seanlynnwyman.elitemarketingpro.com

Elite Marketing Pro is a global community of over 50,000 active small business entrepreneurs, providing targeted education, training, and mentoring programs

92,015 $ 90,000.00

Косметика Vichy. Официальный сайт на русском языке и интернет магазин

- vichyconsult.ru

Официальный интернет магазин Vichy (Виши) в России предлагает аптечную косметику по уходу за кожей и волосами. Широкий ассортимент, рекомендации по уходу за кожей, онлайн-диагностика на сайте.

92,017 $ 158,400.00

Games for Girls - AgnesGames.com

- agnesgames.com

Play free online girl games at AgnesGames.com

92,017 $ 158,400.00

A Link Directory

- alinkdirectory.info

Submit your web site free for review and inclusion to our fast growing free link directory.

92,017 $ 158,400.00

Full WHOIS Lookup

Domain Name: PAGII.COM
Registry Domain ID: 998459831_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-05-30T14:17:05Z
Creation Date: 2007-05-29T05:22:39Z
Registrar Registration Expiration Date: 2020-05-29T05:22:39Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Registrant Street: DomainsByProxy.com
Registrant Street: 14455 N. Hayden Road
Registrant City: Scottsdale
Registrant State/Province: Arizona
Registrant Postal Code: 85260
Registrant Country: US
Registrant Phone: +1.4806242599
Registrant Phone Ext:
Registrant Fax: +1.4806242598
Registrant Fax Ext:
Registrant Email: PAGII.COM@domainsbyproxy.com
Registry Admin ID: Not Available From Registry
Admin Name: Registration Private
Admin Organization: Domains By Proxy, LLC
Admin Street: DomainsByProxy.com
Admin Street: 14455 N. Hayden Road
Admin City: Scottsdale
Admin State/Province: Arizona
Admin Postal Code: 85260
Admin Country: US
Admin Phone: +1.4806242599
Admin Phone Ext:
Admin Fax: +1.4806242598
Admin Fax Ext:
Admin Email: PAGII.COM@domainsbyproxy.com
Registry Tech ID: Not Available From Registry
Tech Name: Registration Private
Tech Organization: Domains By Proxy, LLC
Tech Street: DomainsByProxy.com
Tech Street: 14455 N. Hayden Road
Tech City: Scottsdale
Tech State/Province: Arizona
Tech Postal Code: 85260
Tech Country: US
Tech Phone: +1.4806242599
Tech Phone Ext:
Tech Fax: +1.4806242598
Tech Fax Ext:
Tech Email: PAGII.COM@domainsbyproxy.com
Name Server: SK.S5.ANS1.NS142.ZTOMY.COM
Name Server: SK.S5.ANS2.NS142.ZTOMY.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-11T14:00:00Z <<<

For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en

Notes:

IMPORTANT: Port43 will provide the ICANN-required minimum data set per
ICANN Temporary Specification, adopted 17 May 2018.
Visit https://whois.godaddy.com to look up contact data for domains
not covered by GDPR policy.

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.